SCOPe 2.05: Domain d2mqoa_: 2mqo A:

Lineage for d2mqoa_ (2mqo A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (9 species)
   not a true protein

7. Species Rattus norvegicus [TaxId:10116] [272199] (3 PDB entries)

8. Domain d2mqoa_: 2mqo A: [280035]
   automated match to d3r27a_
   protein/RNA complex

Details for d2mqoa_

PDB Entry: 2mqo

PDB Description: structural investigation of hnrnp l bound to rna

PDB Compounds: (A:) Protein Hnrnpl

SCOPe Domain Sequences for d2mqoa_:

Sequence; same for both SEQRES and ATOM records:

>d2mqoa_ d.58.7.0 (A:) automated matches {Rattus norvegicus [TaxId: 10116]}
genyddphktpaspvvhirglidgvveadlvealqefgpisyvvvmpkkrqalvefedvl
gacnavnyaadnqiyiaghpafvnystsqkisrpgdsddsrsvns

Timeline for d2mqoa_:

• d2mqoa_ is new in SCOPe 2.05-stable
  
• d2mqoa_ appears in SCOPe 2.06
  
• d2mqoa_ appears in the current release, SCOPe 2.08