Lineage for d2mqpa_ (2mqp A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195631Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2195632Protein automated matches [190896] (11 species)
    not a true protein
  7. 2195825Species Norway rat (Rattus norvegicus) [TaxId:10116] [272199] (3 PDB entries)
  8. 2195827Domain d2mqpa_: 2mqp A: [280034]
    automated match to d2e5ia_
    protein/RNA complex

Details for d2mqpa_

PDB Entry: 2mqp (more details)

PDB Description: structural investigation of hnrnp l bound to rna
PDB Compounds: (A:) Protein Hnrnpl

SCOPe Domain Sequences for d2mqpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mqpa_ d.58.7.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qkisrpgdsddsrsvnsvllftilnpiysittdvlyticnpcgpvqrivifrkngvqamv
efdsvqsaqrakaslngadiysgcctlkieyakptrlnvfkndqdtwdytnpnlsgqg

SCOPe Domain Coordinates for d2mqpa_:

Click to download the PDB-style file with coordinates for d2mqpa_.
(The format of our PDB-style files is described here.)

Timeline for d2mqpa_: