![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) ![]() has a circularly permuted topology |
![]() | Family d.142.2.2: Adenylation domain of NAD+-dependent DNA ligase [56096] (2 proteins) automatically mapped to Pfam PF01653 |
![]() | Protein automated matches [194553] (3 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [279926] (2 PDB entries) |
![]() | Domain d5fpoa_: 5fpo A: [280033] automated match to d3jsla_ protein/DNA complex; complexed with 10l |
PDB Entry: 5fpo (more details), 1.83 Å
SCOPe Domain Sequences for d5fpoa_:
Sequence, based on SEQRES records: (download)
>d5fpoa_ d.142.2.2 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} dlssrvnelhdllnqysyeyyvednpsvpdseydkllhelikieeehpeyktvdsptvrv ggeaqasfnkvnhdtpmlslgnafneddlrkfdqrireqignveymcelkidglavslky vdgyfvqgltrgdgttgeditenlktihaiplkmkeplnvevrgeaymprrsflrlneek ekndeqlfanprnaaagslrqldskltakrklsvfiysvndftdfnarsqsealdeldkl gfttnknrarvnnidgvleyiekwtsqreslpydidgivikvndldqqdemgftqksprw aiaykfp
>d5fpoa_ d.142.2.2 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} dlssrvnelhdllnqysyeyyvednpsvpdseydkllhelikieeehpeyktvdsptvrv ggeaqasfnkvnhdtpmlslgnafneddlrkfdqrireqignveymcelkidglavslky vdgyfvqgltrgdgttgeditenlktihaiplkmkeplnvevrgeaymprrsflrlneek ekneqlfanprnaaagslrqldskltakrklsvfiysvndftdfnarsqsealdeldklg fttnknrarvnnidgvleyiekwtsqreslpydidgivikvndldqqdemgftqksprwa iaykfp
Timeline for d5fpoa_: