Lineage for d5f6qb_ (5f6q B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1900809Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 1900810Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 1901256Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 1901257Protein automated matches [190239] (18 species)
    not a true protein
  7. 1901263Species Bacillus anthracis [TaxId:1392] [280024] (1 PDB entry)
  8. 1901264Domain d5f6qb_: 5f6q B: [280025]
    automated match to d4ir0a_
    complexed with cl, gol, k, so4, zn

Details for d5f6qb_

PDB Entry: 5f6q (more details), 1.52 Å

PDB Description: crystal structure of metallothiol transferase from bacillus anthracis str. ames
PDB Compounds: (B:) Metallothiol transferase fosB 2

SCOPe Domain Sequences for d5f6qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f6qb_ d.32.1.0 (B:) automated matches {Bacillus anthracis [TaxId: 1392]}
amlqginhicfsvsnleksiefyqkilqakllvkgrklayfdlnglwialnveediprne
ikqsythmaftvtnealdhlkevliqndvnilpgrerderdqrslyftdpdghkfefhtg
tlqnrleyykedkkhmtfyi

SCOPe Domain Coordinates for d5f6qb_:

Click to download the PDB-style file with coordinates for d5f6qb_.
(The format of our PDB-style files is described here.)

Timeline for d5f6qb_:

  • d5f6qb_ appears in periodic updates to SCOPe 2.05 starting on 2015-12-23
  • d5f6qb_ is called d5f6qb1 in SCOPe 2.06
  • d5f6qb_ appears in the current release, SCOPe 2.07, called d5f6qb1