Lineage for d5br4a_ (5br4 A:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1953870Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily)
    2 domains: (1) alpha/beta of a Rossmann-fold topology, binds NAD (2) multihelical array
  4. 1953871Superfamily e.22.1: Dehydroquinate synthase-like [56796] (3 families) (S)
  5. 1953901Family e.22.1.2: Iron-containing alcohol dehydrogenase [69892] (6 proteins)
    Pfam PF00465
  6. 1953929Protein automated matches [190216] (2 species)
    not a true protein
  7. 1953930Species Escherichia coli [TaxId:562] [186975] (3 PDB entries)
  8. 1953931Domain d5br4a_: 5br4 A: [279997]
    automated match to d1rrma_
    complexed with cl, gol, nad, zn; mutant

Details for d5br4a_

PDB Entry: 5br4 (more details), 0.91 Å

PDB Description: e. coli lactaldehyde reductase (fuco) m185c mutant
PDB Compounds: (A:) lactaldehyde reductase

SCOPe Domain Sequences for d5br4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5br4a_ e.22.1.2 (A:) automated matches {Escherichia coli [TaxId: 562]}
mmanrmilnetawfgrgavgaltdevkrrgyqkalivtdktlvqcgvvakvtdkmdaagl
awaiydgvvpnptitvvkeglgvfqnsgadyliaigggspqdtckaigiisnnpefadvr
sleglsptnkpsvpilaipttagtaaevtinyvitdeekrrkfvcvdphdipqvafidad
mmdgcppalkaatgvdalthaiegyitrgawaltdalhikaieiiagalrgsvagdkdag
eemalgqyvagmgfsnvglglvhgmahplgafyntphgvanaillphvmrynadftgeky
rdiarvmgvkvegmsleearnaaveavfalnrdvgipphlrdvgvrkedipalaqaaldd
vctggnpreatledivelyhtawle

SCOPe Domain Coordinates for d5br4a_:

Click to download the PDB-style file with coordinates for d5br4a_.
(The format of our PDB-style files is described here.)

Timeline for d5br4a_: