Lineage for d4zz2a_ (4zz2 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864352Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 1864353Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 1864354Family c.65.1.1: Formyltransferase [53329] (5 proteins)
  6. 1864361Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species)
  7. 1864383Species Human (Homo sapiens) [TaxId:9606] [82468] (18 PDB entries)
  8. 1864388Domain d4zz2a_: 4zz2 A: [279993]
    automated match to d4ew1a_
    complexed with 3yg, gar

Details for d4zz2a_

PDB Entry: 4zz2 (more details), 1.45 Å

PDB Description: human gar transformylase in complex with gar and (s)-2-({5-[3-(2- amino-4-oxo-4,7-dihydro-3h-pyrrolo[2,3-d]pyrimidin-6-yl)-propyl]- thiophene-3-carbonyl}-amino)-pentanedioic acid
PDB Compounds: (A:) Trifunctional purine biosynthetic protein adenosine-3

SCOPe Domain Sequences for d4zz2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zz2a_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]}
arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
lqlvasgtvqlgengkicwv

SCOPe Domain Coordinates for d4zz2a_:

Click to download the PDB-style file with coordinates for d4zz2a_.
(The format of our PDB-style files is described here.)

Timeline for d4zz2a_: