Lineage for d4zz3a_ (4zz3 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144933Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 2144934Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 2144935Family c.65.1.1: Formyltransferase [53329] (5 proteins)
  6. 2144942Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species)
  7. 2144964Species Human (Homo sapiens) [TaxId:9606] [82468] (27 PDB entries)
  8. 2145006Domain d4zz3a_: 4zz3 A: [279991]
    automated match to d4ew1a_
    complexed with 4dw, gar

Details for d4zz3a_

PDB Entry: 4zz3 (more details), 2.5 Å

PDB Description: human gar transformylase in complex with gar and pemetrexed
PDB Compounds: (A:) Trifunctional purine biosynthetic protein adenosine-3

SCOPe Domain Sequences for d4zz3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zz3a_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]}
arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
lqlvasgtvqlgengkicwv

SCOPe Domain Coordinates for d4zz3a_:

Click to download the PDB-style file with coordinates for d4zz3a_.
(The format of our PDB-style files is described here.)

Timeline for d4zz3a_: