Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (25 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [194605] (24 PDB entries) |
Domain d4yomb1: 4yom B:13-342 [279987] Other proteins in same PDB: d4yomb2 automated match to d1zmub_ complexed with edo |
PDB Entry: 4yom (more details), 2.49 Å
SCOPe Domain Sequences for d4yomb1:
Sequence, based on SEQRES records: (download)
>d4yomb1 d.144.1.0 (B:13-342) automated matches {Mouse (Mus musculus) [TaxId: 10090]} haqyvgpyrlektlgkgqtglvklgihcvtcqkvaikivnreklsesvlmkvereiailk liehphvlklhdvyenkkylylvlehvsggelfdylvkkgrltpkearkffrqiisaldf chshsichrdlkpenllldernniriadfgmaslqvgdslletscgsphyacpevirgek ydgrkadvwscgvilfallvgalpfdddnlrqllekvkrgvfhmphfippdcqsllrgmi evdaarrltlehiqkhiwyiggknepepeqpiprkvqirslpsledidpdvldsmhslgc frdrnkllqdllseeenqekmiyfllldrk
>d4yomb1 d.144.1.0 (B:13-342) automated matches {Mouse (Mus musculus) [TaxId: 10090]} haqyvgpyrlektlgkgqtglvklgihcvtcqkvaikivnreklsesvlmkvereiailk liehphvlklhdvyenkkylylvlehvsggelfdylvkkgrltpkearkffrqiisaldf chshsichrdlkpenllldernniriadfgmaslqvgdslletscgsphyacpevirgek ydgrkadvwscgvilfallvgalpfdddnlrqllekvkrgvfhmphfippdcqsllrgmi evdaarrltlehiqkhiwyiggknkvqirslpsledidpdvldsmhslgcfrdrnkllqd llseeenqekmiyfllldrk
Timeline for d4yomb1: