SCOPe 2.05: Domain d4xazg_: 4xaz G:

Lineage for d4xazg_ (4xaz G:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
   automatically mapped to Pfam PF02126

6. Protein automated matches [190258] (2 species)
   not a true protein

7. Species Brevundimonas diminuta [TaxId:293] [194088] (12 PDB entries)

8. Domain d4xazg_: 4xaz G: [279940]
   automated match to d1qw7a_
   complexed with mpd, zn

Details for d4xazg_

PDB Entry: 4xaz, 1.55 Å

PDB Description: cycles of destabilization and repair underlie evolutionary transitions in enzymes

PDB Compounds: (G:) Phosphotriesterase variant PTE-R18

SCOPe Domain Sequences for d4xazg_:

Sequence; same for both SEQRES and ATOM records:

>d4xazg_ c.1.9.3 (G:) automated matches {Brevundimonas diminuta [TaxId: 293]}
rintvrgpitisevgftlthehicgssagflrawpeffgsrealvekavrglrraraagv
rtivdvstfdlgrdvrllaevsraadvhivaatgvwldpplsirmrsveeltqfflreiq
ygiedtgiragiikvaitgkvtpfqelvlraaaraslatgvpvithtagsqrggeqqaai
feseglspsrvcighsdetddlsyltalaargyligldriphsaiglednasatafmgsr
swqtrallikalidqgymkqilvsndwlfgissyvtnfmdvmdsvnpdgmafiplrvipf
lrekgipqetlagitvtnparflsptl

Timeline for d4xazg_:

• d4xazg_ is new in SCOPe 2.05-stable
  
• d4xazg_ appears in SCOPe 2.06
  
• d4xazg_ appears in the current release, SCOPe 2.08