Lineage for d4x9ab_ (4x9a B:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2250642Fold e.75: Flu NP-like [161002] (1 superfamily)
    consists of alpha+beta and all-alpha domains; biological unit is a trimer
  4. 2250643Superfamily e.75.1: flu NP-like [161003] (1 family) (S)
    automatically mapped to Pfam PF00506
  5. 2250644Family e.75.1.1: Flu NP-like [161004] (2 protein domains)
    Pfam PF00506; Influenza virus nucleoprotein
  6. 2250645Protein Nucleocapsid protein [161005] (1 species)
  7. 2250646Species Influenza A virus [TaxId:11320] [161006] (11 PDB entries)
    Uniprot Q1I2B5 21-489
  8. 2250666Domain d4x9ab_: 4x9a B: [279934]
    automated match to d4dynb_
    complexed with nuz

Details for d4x9ab_

PDB Entry: 4x9a (more details), 2.99 Å

PDB Description: nucleoprotein-nucleozin complex
PDB Compounds: (B:) nucleoprotein

SCOPe Domain Sequences for d4x9ab_:

Sequence, based on SEQRES records: (download)

>d4x9ab_ e.75.1.1 (B:) Nucleocapsid protein {Influenza A virus [TaxId: 11320]}
nateirasvgkmidgigrfyiqmctelklsdyegrliqnsltiermvlsafderrnkyle
ehpsagkdpkktggpiyrrvdgkwrrelilydkeeirriwrqanngddataglthmmiwh
snlndatyqrtralvrtgmdprmcslmqgstlprrsgaagaavkgvgtmvmelirmikrg
indrnfwrgengrrtriayermcnilkgkfqtaaqrtmvdqvresrnpgnaefedlifla
rsalilrgsvahksclpacvygsavasgydferegyslvgidpfrllqnsqvyslirpne
npahksqlvwmachsaafedlrvssfirgtkvvprgklstrgvqiasnenmetmesstle
lrsrywairtrsggntnqqrassgqisiqptfsvqrnlpfdrptimaaftgntegrtsdm
rteiirlmesarpedvsfqgrgvfelsdekatspivpsfdmsnegsyff

Sequence, based on observed residues (ATOM records): (download)

>d4x9ab_ e.75.1.1 (B:) Nucleocapsid protein {Influenza A virus [TaxId: 11320]}
nateirasvgkmidgigrfyiqmctelklsdyegrliqnsltiermvlsafdtggpiyrr
vdgkwrrelilydkeeirriwrqanngddataglthmmiwhsnlndatyqrtralvrtgm
dprmcslmqgstlprrsgaagaavkgvgtmvmelirmikrgirrtriayermcnilkgkf
qtaaqrtmvdqvresrnpgnaefedliflarsalilrgsvahksclpacvygsavasgyd
feregyslvgidpfrllqnsqvyslirpnenpahksqlvwmachsaafedlrvssfirgt
kvvprgklstrgvqiasnenmetmesstlelrsrywairtrsggntsgqisiqptfsvqr
nlpfdrptimaasdmrteiirlmesarpedvsfqgrgvfelsdekatspivpsfdmsngs
yff

SCOPe Domain Coordinates for d4x9ab_:

Click to download the PDB-style file with coordinates for d4x9ab_.
(The format of our PDB-style files is described here.)

Timeline for d4x9ab_: