Lineage for d5ew3b_ (5ew3 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2983234Protein Vascular endothelial growth factor receptor 2 (kdr) [56160] (1 species)
    PTK group; PDGFR/VEGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2983235Species Human (Homo sapiens) [TaxId:9606] [56161] (30 PDB entries)
  8. 2983263Domain d5ew3b_: 5ew3 B: [279929]
    automated match to d4agca_
    complexed with 5t2

Details for d5ew3b_

PDB Entry: 5ew3 (more details), 2.5 Å

PDB Description: human vascular endothelial growth factor receptor 2 (kdr) kinase domain in complex with aal993
PDB Compounds: (B:) Vascular endothelial growth factor receptor 2

SCOPe Domain Sequences for d5ew3b_:

Sequence, based on SEQRES records: (download)

>d5ew3b_ d.144.1.7 (B:) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]}
lpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlkegathseh
ralmselkilihighhlnvvnllgactkpggplmvivefckfgnlstylrskrnefvpyk
vapedlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdfgl
ardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslgaspypgv
kideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnllq

Sequence, based on observed residues (ATOM records): (download)

>d5ew3b_ d.144.1.7 (B:) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]}
lpydaskwefprdrlklgkplggqvieadafgidktatcrtvavkmlkegathsehralm
selkilihighhlnvvnllgactkpggplmvivefckfgnlstylrskrnefvpykdflt
lehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdfglplkwmapetifd
rvytiqsdvwsfgvllweifslgaspypgvkideefcrrlkegtrmrapdyttpemyqtm
ldcwhgepsqrptfselvehlgnllq

SCOPe Domain Coordinates for d5ew3b_:

Click to download the PDB-style file with coordinates for d5ew3b_.
(The format of our PDB-style files is described here.)

Timeline for d5ew3b_: