![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) ![]() has a circularly permuted topology |
![]() | Family d.142.2.2: Adenylation domain of NAD+-dependent DNA ligase [56096] (2 proteins) automatically mapped to Pfam PF01653 |
![]() | Protein automated matches [194553] (3 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [279926] (2 PDB entries) |
![]() | Domain d5fpra_: 5fpr A: [279927] automated match to d3jsla_ protein/DNA complex; complexed with lga, so4 |
PDB Entry: 5fpr (more details), 2 Å
SCOPe Domain Sequences for d5fpra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fpra_ d.142.2.2 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} dlssrvnelhdllnqysyeyyvednpsvpdseydkllhelikieeehpeyktvdsptvrv ggeaqasfnkvnhdtpmlslgnafneddlrkfdqrireqignveymcelkidglavslky vdgyfvqgltrgdgttgeditenlktihaiplkmkeplnvevrgeaymprrsflrlneek ekndeqlfanprnaaagslrqldskltakrklsvfiysvndftdfnarsqsealdeldkl gfttnknrarvnnidgvleyiekwtsqreslpydidgivikvndldqqdemgftqksprw aiaykfp
Timeline for d5fpra_: