Lineage for d5fpra_ (5fpr A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217268Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2217840Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) (S)
    has a circularly permuted topology
  5. 2217856Family d.142.2.2: Adenylation domain of NAD+-dependent DNA ligase [56096] (2 proteins)
    automatically mapped to Pfam PF01653
  6. 2217884Protein automated matches [194553] (3 species)
    not a true protein
  7. 2217887Species Staphylococcus aureus [TaxId:1280] [279926] (2 PDB entries)
  8. 2217889Domain d5fpra_: 5fpr A: [279927]
    automated match to d3jsla_
    protein/DNA complex; complexed with lga, so4

Details for d5fpra_

PDB Entry: 5fpr (more details), 2 Å

PDB Description: structure of bacterial dna ligase with small-molecule ligand pyrimidin-2-amine (at371) in an alternate binding site.
PDB Compounds: (A:) DNA ligase

SCOPe Domain Sequences for d5fpra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fpra_ d.142.2.2 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
dlssrvnelhdllnqysyeyyvednpsvpdseydkllhelikieeehpeyktvdsptvrv
ggeaqasfnkvnhdtpmlslgnafneddlrkfdqrireqignveymcelkidglavslky
vdgyfvqgltrgdgttgeditenlktihaiplkmkeplnvevrgeaymprrsflrlneek
ekndeqlfanprnaaagslrqldskltakrklsvfiysvndftdfnarsqsealdeldkl
gfttnknrarvnnidgvleyiekwtsqreslpydidgivikvndldqqdemgftqksprw
aiaykfp

SCOPe Domain Coordinates for d5fpra_:

Click to download the PDB-style file with coordinates for d5fpra_.
(The format of our PDB-style files is described here.)

Timeline for d5fpra_: