Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.2: Thermolysin-like [55490] (5 proteins) includes alpha-helical C-terminal domain characteristic for the family |
Protein Thermolysin [63414] (3 species) |
Species Thermus thermophilus [TaxId:274] [279924] (2 PDB entries) |
Domain d5f80a_: 5f80 A: [279925] automated match to d4n4ee_ complexed with ca, leu, trp, zn |
PDB Entry: 5f80 (more details), 2.5 Å
SCOPe Domain Sequences for d5f80a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f80a_ d.92.1.2 (A:) Thermolysin {Thermus thermophilus [TaxId: 274]} itgtstvgvgrgvlgdqkninttystyyylqdntrgdgiftydakyrttlpgslwadadn qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsem vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts qevasvkqafdavgvk
Timeline for d5f80a_: