Lineage for d5dfva_ (5dfv A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1750813Fold a.135: Tetraspanin [48651] (1 superfamily)
    5 helices: irregular disulfide-linked array; form homodimer
  4. 1750814Superfamily a.135.1: Tetraspanin [48652] (1 family) (S)
  5. 1750815Family a.135.1.1: Tetraspanin [48653] (2 proteins)
  6. 1750822Protein automated matches [256548] (3 species)
    not a true protein
  7. 1750825Species Human (Homo sapiens) [TaxId:9606] [256549] (6 PDB entries)
  8. 1750839Domain d5dfva_: 5dfv A: [279893]
    automated match to d4bkha_

Details for d5dfva_

PDB Entry: 5dfv (more details), 2.8 Å

PDB Description: crystal structure of human cd81 large extracellular loop in complex with murine fab fragment k04
PDB Compounds: (A:) CD81 antigen

SCOPe Domain Sequences for d5dfva_:

Sequence, based on SEQRES records: (download)

>d5dfva_ a.135.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlkn
nlcpsgsniisnlfkedchqkiddlfsgkh

Sequence, based on observed residues (ATOM records): (download)

>d5dfva_ a.135.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlkn
nlcpsniisnlfkedchqkiddlfsgkh

SCOPe Domain Coordinates for d5dfva_:

Click to download the PDB-style file with coordinates for d5dfva_.
(The format of our PDB-style files is described here.)

Timeline for d5dfva_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5dfvb_