SCOPe 2.05: Domain d5aoka_: 5aok A:

Lineage for d5aoka_ (5aok A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)

6. Protein automated matches [190198] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186941] (47 PDB entries)

8. Domain d5aoka_: 5aok A: [279881]
   automated match to d2feja_
   complexed with goh, gol, peg, zn; mutant

Details for d5aoka_

PDB Entry: 5aok, 1.35 Å

PDB Description: structure of the p53 cancer mutant y220c with bound small molecule phikan7099

PDB Compounds: (A:) Cellular tumor antigen p53

SCOPe Domain Sequences for d5aoka_:

Sequence; same for both SEQRES and ATOM records:

>d5aoka_ b.2.5.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfrhs
vvvpceppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevrvc
acpgrdrrteeenlr

Timeline for d5aoka_:

• d5aoka_ is new in SCOPe 2.05-stable
  
• d5aoka_ appears in SCOPe 2.06
  
• d5aoka_ appears in the current release, SCOPe 2.08