Lineage for d4y31a_ (4y31 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2582036Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2582037Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)
  6. 2582089Protein Plant pathogenesis-related protein PR10 [75543] (2 species)
  7. 2582092Species Yellow lupine (Lupinus luteus) [TaxId:3873] [75544] (6 PDB entries)
  8. 2582093Domain d4y31a_: 4y31 A: [279858]
    automated match to d1icxa_
    complexed with act

Details for d4y31a_

PDB Entry: 4y31 (more details), 1.32 Å

PDB Description: crystal structure of yellow lupine llpr-10.1a protein in ligand-free form
PDB Compounds: (A:) protein llr18a

SCOPe Domain Sequences for d4y31a_:

Sequence, based on SEQRES records: (download)

>d4y31a_ d.129.3.1 (A:) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]}
gifafeneqsstvapaklykaltkdsdeivpkviepiqsveivegnggpgtikkiiaihd
ghtsfvlhkldaideanltynysiiggegldeslekisyeskilpgpdggsigkinvkfh
tkgdvlsetvrdqakfkglglfkaiegyvlahpdy

Sequence, based on observed residues (ATOM records): (download)

>d4y31a_ d.129.3.1 (A:) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]}
gifafeneqsstvapaklykaltkdsdeivpkviepiqsveivegnggpgtikkiiaiht
sfvlhkldaideanltynysiiggegldeslekisyeskilpgpdggsigkinvkfhtkg
dvlsetvrdqfkglglfkaiegyvlahpdy

SCOPe Domain Coordinates for d4y31a_:

Click to download the PDB-style file with coordinates for d4y31a_.
(The format of our PDB-style files is described here.)

Timeline for d4y31a_: