Lineage for d4xzug_ (4xzu G:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2046279Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2046280Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2046303Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (4 proteins)
    automatically mapped to Pfam PF00754
  6. 2046344Protein automated matches [190377] (2 species)
    not a true protein
  7. 2046345Species Human (Homo sapiens) [TaxId:9606] [187224] (7 PDB entries)
  8. 2046355Domain d4xzug_: 4xzu G: [279856]
    Other proteins in same PDB: d4xzub1, d4xzub2, d4xzuf1, d4xzuf2
    automated match to d3hnym_
    complexed with mg

Details for d4xzug_

PDB Entry: 4xzu (more details), 2.61 Å

PDB Description: crystal structure of the human factor viii c2 domain in complex with murine 3e6 inhibitory antibody
PDB Compounds: (G:) coagulation factor viii

SCOPe Domain Sequences for d4xzug_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xzug_ b.18.1.2 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
csmplgmeskaisdaqitassyftnmfatwspskarlhlqgrsnawrpqvnnpkewlqvd
fqktmkvtgvttqgvkslltsmyvkeflisssqdghqwtlffqngkvkvfqgnqdsftpv
vnsldpplltrylrihpqswvhqialrmevlgce

SCOPe Domain Coordinates for d4xzug_:

Click to download the PDB-style file with coordinates for d4xzug_.
(The format of our PDB-style files is described here.)

Timeline for d4xzug_: