Lineage for d4tlqb_ (4tlq B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908987Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 1908988Protein automated matches [190896] (9 species)
    not a true protein
  7. 1909006Species Human (Homo sapiens) [TaxId:9606] [188315] (74 PDB entries)
  8. 1909067Domain d4tlqb_: 4tlq B: [279846]
    automated match to d2mika_

Details for d4tlqb_

PDB Entry: 4tlq (more details), 2.5 Å

PDB Description: crystal structure of c-terminal rna recognition motif of human elav type rna binding protein-3 at 2.5 angstrom resolution
PDB Compounds: (B:) CUGBP Elav-like family member 2

SCOPe Domain Sequences for d4tlqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tlqb_ d.58.7.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egpeganlfiyhlpqefgdqdilqmfmpfgnvisakvfidkqtnlskcfgfvsydnpvsa
qaaiqamngfqigmkrlkvqlkr

SCOPe Domain Coordinates for d4tlqb_:

Click to download the PDB-style file with coordinates for d4tlqb_.
(The format of our PDB-style files is described here.)

Timeline for d4tlqb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4tlqa_