Class b: All beta proteins [48724] (176 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (4 families) SH3-like barrel is capped by a C-terminal helix |
Family b.34.13.2: Chromo domain [54165] (8 proteins) lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold |
Protein automated matches [191035] (3 species) not a true protein |
Species Arabidopsis thaliana [TaxId:3702] [279724] (2 PDB entries) |
Domain d2n88a_: 2n88 A: [279835] automated match to d1x3pa1 |
PDB Entry: 2n88 (more details)
SCOPe Domain Sequences for d2n88a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2n88a_ b.34.13.2 (A:) automated matches {Arabidopsis thaliana [TaxId: 3702]} gleyavaesvigkrvgddgktieylvkwtdmsdatwepqdnvdstlvllyqqqqpmne
Timeline for d2n88a_: