Lineage for d2n88a_ (2n88 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1785119Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 1785158Family b.34.13.2: Chromo domain [54165] (8 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 1785235Protein automated matches [191035] (3 species)
    not a true protein
  7. 1785236Species Arabidopsis thaliana [TaxId:3702] [279724] (2 PDB entries)
  8. 1785238Domain d2n88a_: 2n88 A: [279835]
    automated match to d1x3pa1

Details for d2n88a_

PDB Entry: 2n88 (more details)

PDB Description: chromodomain 3 (cd3) of cpsrp43
PDB Compounds: (A:) Signal recognition particle 43 kDa protein, chloroplastic

SCOPe Domain Sequences for d2n88a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n88a_ b.34.13.2 (A:) automated matches {Arabidopsis thaliana [TaxId: 3702]}
gleyavaesvigkrvgddgktieylvkwtdmsdatwepqdnvdstlvllyqqqqpmne

SCOPe Domain Coordinates for d2n88a_:

Click to download the PDB-style file with coordinates for d2n88a_.
(The format of our PDB-style files is described here.)

Timeline for d2n88a_: