Lineage for d5d0kd_ (5d0k D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898312Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1898313Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1898314Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1898507Protein automated matches [190124] (12 species)
    not a true protein
  7. 1898519Species Human (Homo sapiens) [TaxId:9606] [186848] (39 PDB entries)
  8. 1898588Domain d5d0kd_: 5d0k D: [279801]
    Other proteins in same PDB: d5d0kb_, d5d0ke_, d5d0kh_, d5d0kk_
    automated match to d3tgda_
    complexed with zn

Details for d5d0kd_

PDB Entry: 5d0k (more details), 2.65 Å

PDB Description: structure of ube2d2:rnf165:ub complex
PDB Compounds: (D:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d5d0kd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d0kd_ d.20.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smalkrihkelndlardppaqssagpvgddmfhwqatimgpndspyqggvffltihfptd
ypfkppkvafttriyhpninsngsikldilrsqwspaltiskvllsissllsdpnpddpl
vpeiariyktdrekynriarewtqkyam

SCOPe Domain Coordinates for d5d0kd_:

Click to download the PDB-style file with coordinates for d5d0kd_.
(The format of our PDB-style files is described here.)

Timeline for d5d0kd_: