Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein automated matches [190124] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186848] (39 PDB entries) |
Domain d5d0kg_: 5d0k G: [279798] Other proteins in same PDB: d5d0kb_, d5d0ke_, d5d0kh_, d5d0kk_ automated match to d3tgda_ complexed with zn |
PDB Entry: 5d0k (more details), 2.65 Å
SCOPe Domain Sequences for d5d0kg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d0kg_ d.20.1.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} smalkrihkelndlardppaqssagpvgddmfhwqatimgpndspyqggvffltihfptd ypfkppkvafttriyhpninsngsikldilrsqwspaltiskvllsissllsdpnpddpl vpeiariyktdrekynriarewtqkyam
Timeline for d5d0kg_: