![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.1: UBC-related [54496] (7 proteins) |
![]() | Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species) |
![]() | Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (24 PDB entries) Uniprot P62837 E2-17 kDa 2 |
![]() | Domain d5d0ma_: 5d0m A: [279797] Other proteins in same PDB: d5d0mb_ automated match to d3tgda_ complexed with po4, zn |
PDB Entry: 5d0m (more details), 1.91 Å
SCOPe Domain Sequences for d5d0ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d0ma_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]} malkrihkelndlardppaqsragpvgddmfhwqatimgpndspyqggvffltihfptdy pfkppkvafttriyhpninsngsikldilrsqwspaltiskvllsissllsdpnpddplv peiariyktdrekynriarewtqkyam
Timeline for d5d0ma_: