Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (132 species) not a true protein |
Species Fall armyworm (Spodoptera frugiperda) [TaxId:7108] [279776] (1 PDB entry) |
Domain d5cg0d_: 5cg0 D: [279781] automated match to d3viia_ complexed with nag, trs |
PDB Entry: 5cg0 (more details), 2.09 Å
SCOPe Domain Sequences for d5cg0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cg0d_ c.1.8.0 (D:) automated matches {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]} rrfpddflfgtatasyqiegawdedgkgeniwdymvhntpevirdlsngdiaadsyhnyk rdvemmrelgldayrfslswarilptgmanevnpagiafynnyidemlkynitplitlyh wdlpqklqelggfanplisdwfedyarvvfenfgdrvkmfitfnepreicfegygsatka pilnatamgaylcaknlvtahakayylydrefrpvqggqcgitisvnwfgpatptpedem aaelrrqgewgiyahpifsaeggfpkelsdkiaeksaqqgypwsrlpefteeekafvrgt sdffgvnhytaflvsaterkgpypvpsllddvdtgswaddswlksasawltlapnsihta lthlnnlynkpvfyitengwstdesrenslidddriqyyrasmesllnclddginlkgym awslmdnfewmegyierfglyevdfsdpartrtprkaafvykhiikhrvvdyeyepetmv mtideg
Timeline for d5cg0d_: