SCOP 1.71: Domain d1dlc_2: 1dlc 290-499

Lineage for d1dlc_2 (1dlc 290-499)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.77: beta-Prism I [51091] (3 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.2: delta-Endotoxin (insectocide), middle domain [51096] (1 family)

5. Family b.77.2.1: delta-Endotoxin (insectocide), middle domain [51097] (1 protein)

6. Protein delta-Endotoxin (insectocide), middle domain [51098] (4 species)

7. Species Bacillus thuringiensis tenebrionis, CRYIIIA (BT13) [TaxId:1444] [51099] (1 PDB entry)

8. Domain d1dlc_2: 1dlc 290-499 [27976]
   Other proteins in same PDB: d1dlc_1, d1dlc_3

Details for d1dlc_2

PDB Entry: 1dlc, 2.5 Å

PDB Description: crystal structure of insecticidal delta-endotoxin from bacillus thuringiensis at 2.5 angstroms resolution

SCOP Domain Sequences for d1dlc_2:

Sequence; same for both SEQRES and ATOM records:

>d1dlc_2 b.77.2.1 (290-499) delta-Endotoxin (insectocide), middle domain {Bacillus thuringiensis tenebrionis, CRYIIIA (BT13)}
lypkevkteltrdvltdpivgvnnlrgygttfsnienyirkphlfdylhriqfhtrfqpg
yygndsfnywsgnyvstrpsigsndiitspfygnkssepvqnlefngekvyravantnla
vwpsavysgvtkvefsqyndqtdeastqtydskrnvgavswdsidqlppettdeplekgy
shqlnyvmcflmqgsrgtipvltwthksvd

Timeline for d1dlc_2:

• d1dlc_2 first appeared (with stable ids) in SCOP 1.55
  
• d1dlc_2 appears in SCOP 1.69
  
• d1dlc_2 is called d1dlca2 in SCOP 1.73
  
• d1dlc_2 appears in the current release, SCOPe 2.08, called d1dlca2