Lineage for d2mzra1 (2mzr A:144-236)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195631Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2195632Protein automated matches [190896] (11 species)
    not a true protein
  7. 2195650Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [279753] (6 PDB entries)
  8. 2195656Domain d2mzra1: 2mzr A:144-236 [279756]
    Other proteins in same PDB: d2mzra2
    automated match to d2dh9a_

Details for d2mzra1

PDB Entry: 2mzr (more details)

PDB Description: nmr structure of the rrm1 domain of hrb1
PDB Compounds: (A:) Protein HRB1

SCOPe Domain Sequences for d2mzra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mzra1 d.58.7.0 (A:144-236) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
areldstyeekvnrnysnsifvgnltydstpedlteffsqigkvvradiitsrghhrgmg
tveftnsddvdrairqydgaffmdrkifvrqdn

SCOPe Domain Coordinates for d2mzra1:

Click to download the PDB-style file with coordinates for d2mzra1.
(The format of our PDB-style files is described here.)

Timeline for d2mzra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mzra2