Lineage for d5ex4a_ (5ex4 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1821671Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1822914Family c.1.10.8: Class-II DAHP synthetase [141840] (2 proteins)
    Pfam PF01474
  6. 1822915Protein Probable DAHP synthetase AroG, phenylalanine-repressible [141841] (1 species)
  7. 1822916Species Mycobacterium tuberculosis [TaxId:1773] [141842] (6 PDB entries)
    Uniprot O53512 1-462
  8. 1822925Domain d5ex4a_: 5ex4 A: [279745]
    automated match to d3nv8b_
    complexed with cl, gol, mn, po4, so4, trp

Details for d5ex4a_

PDB Entry: 5ex4 (more details), 2.25 Å

PDB Description: 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase from mycobacterium tuberculosis complexed with tryptophan in all three allosteric binding sites
PDB Compounds: (A:) 3-deoxy-D-arabinoheptulosonate-7-phosphate synthase

SCOPe Domain Sequences for d5ex4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ex4a_ c.1.10.8 (A:) Probable DAHP synthetase AroG, phenylalanine-repressible {Mycobacterium tuberculosis [TaxId: 1773]}
mnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppvtv
pseivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygasmp
vvkvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasaam
nlvraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnlqt
aeiyashealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqvia
npvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatghq
viwqcdpmhgnthesstgfktrhfdrivdevqgffevhralgthpggihveitgenvtec
lggaqdisetdlagryetacdprlntqqslelaflvaemlrd

SCOPe Domain Coordinates for d5ex4a_:

Click to download the PDB-style file with coordinates for d5ex4a_.
(The format of our PDB-style files is described here.)

Timeline for d5ex4a_: