Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.248: Coproporphyrinogen III oxidase [102885] (2 superfamilies) alpha-beta(6)-alpha(2)-beta-alpha(n); 3 layers alpha/beta/alpha; antiparallel sheet: order 1234567 |
Superfamily d.248.1: Coproporphyrinogen III oxidase [102886] (2 families) automatically mapped to Pfam PF01218 |
Family d.248.1.1: Coproporphyrinogen III oxidase [102887] (3 proteins) Pfam PF01218 |
Protein automated matches [190407] (4 species) not a true protein |
Species Acinetobacter baumannii [TaxId:470] [279740] (1 PDB entry) |
Domain d5eo6a_: 5eo6 A: [279741] automated match to d1vjub_ complexed with act |
PDB Entry: 5eo6 (more details), 1.45 Å
SCOPe Domain Sequences for d5eo6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5eo6a_ d.248.1.1 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]} mqhptstdiqrvreflldlqaricagleqqekagggtaefiiddwerpeggggrsrvlqn gtviekggvmfshinisklpasaterhpqiagakaqalgvslvihpknpniptshanvrl fvaeredqdpiwwfgggfdltpfypddqdvlnwhqaaydlckpfgdnvyaehkkwcddyf ylkhrdeqrgvgglffddlncwdfetcfkyiqavgngylnailpifekhreqpyteaqre fqlyrrgryveynlvydrgtlfglqtggriesilvslpnlaawsyrpewdedspekrltd yylkprdwlgle
Timeline for d5eo6a_: