Lineage for d5e30d_ (5e30 D:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2266925Protein Influenza hemagglutinin (stalk) [58066] (12 species)
    trimer
  7. 2266962Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 2267283Domain d5e30d_: 5e30 D: [279733]
    Other proteins in same PDB: d5e30a1, d5e30a2, d5e30c1, d5e30c2, d5e30e1, d5e30e2
    automated match to d4kdmb_
    complexed with fuc, ful, gal, nag, sia; mutant

Details for d5e30d_

PDB Entry: 5e30 (more details), 2.7 Å

PDB Description: crystal structure of h5 hemagglutinin q226l mutant from the influenza virus a/duck/egypt/10185ss/2010 (h5n1) with lstc
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d5e30d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e30d_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhrcdnecmesvrngtydypqyseearlkreeisg

SCOPe Domain Coordinates for d5e30d_:

Click to download the PDB-style file with coordinates for d5e30d_.
(The format of our PDB-style files is described here.)

Timeline for d5e30d_: