Lineage for d1fj1f_ (1fj1 F:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1329352Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
    single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
  4. 1329353Superfamily b.76.1: Outer surface protein [51087] (1 family) (S)
    21 stranded sheet partly folded upon itself at the ends
  5. 1329354Family b.76.1.1: Outer surface protein [51088] (3 proteins)
  6. 1329355Protein Outer surface protein A [51089] (1 species)
  7. 1329356Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [51090] (2 PDB entries)
  8. 1329359Domain d1fj1f_: 1fj1 F: [27973]
    Other proteins in same PDB: d1fj1a1, d1fj1a2, d1fj1b1, d1fj1b2, d1fj1c1, d1fj1c2, d1fj1d1, d1fj1d2

Details for d1fj1f_

PDB Entry: 1fj1 (more details), 2.68 Å

PDB Description: lyme disease antigen ospa in complex with neutralizing antibody fab la-2
PDB Compounds: (F:) Outer surface protein A

SCOPe Domain Sequences for d1fj1f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fj1f_ b.76.1.1 (F:) Outer surface protein A {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
sldeknsvsvdlpgemkvlvskeknkdgkydliatvdklelkgtsdknngsgvlegvkad
kckvkltisddlgqttlevfkedgktlvskkvtskdkssteekfnekgevsekiitradg
trleytgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksgevsveln
dtdssaatkktaawnsgtstltitvnskktkdlvftkentitvqqydsngtklegsavei
tkldeiknalk

SCOPe Domain Coordinates for d1fj1f_:

Click to download the PDB-style file with coordinates for d1fj1f_.
(The format of our PDB-style files is described here.)

Timeline for d1fj1f_: