Lineage for d5e2yc_ (5e2y C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778497Protein automated matches [190291] (24 species)
    not a true protein
  7. 1778508Species Influenza a virus (a/duck/egypt/10185ss/2010(h5n1)) [TaxId:1092915] [279705] (2 PDB entries)
  8. 1778510Domain d5e2yc_: 5e2y C: [279722]
    Other proteins in same PDB: d5e2yb_, d5e2yd_, d5e2yf_
    automated match to d4bh4a_
    complexed with fuc, ful, nag; mutant

Details for d5e2yc_

PDB Entry: 5e2y (more details), 2.6 Å

PDB Description: crystal structure of h5 hemagglutinin q226l mutant from the influenza virus a/duck/egypt/10185ss/2010 (h5n1)
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d5e2yc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e2yc_ b.19.1.2 (C:) automated matches {Influenza a virus (a/duck/egypt/10185ss/2010(h5n1)) [TaxId: 1092915]}
dpgdqicigyhannsteqvdtimeknvtvthaqdilekthngklcnldgvkplilrdcsv
agwllgnpmcdeflnvpewsyivekinpandlcypgnfndyeelkhllsrinhfekiqit
pknswsdheasgvssacpyqgrssffrnvvwltkkdnayptikrsynntnqedllvlwgi
hhpndateqtrlyqnpttyisvgtstlnqklvpkiatrskvkglsgrmeffwtilksnda
infesngnfiapenaykivkkgdstimkseleygdcntkcqtpigainssmpfhnihplt
igecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d5e2yc_:

Click to download the PDB-style file with coordinates for d5e2yc_.
(The format of our PDB-style files is described here.)

Timeline for d5e2yc_: