SCOPe 2.06: Domain d5e32b_: 5e32 B:

Lineage for d5e32b_ (5e32 B:)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (12 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)

8. Domain d5e32b_: 5e32 B: [279716]
   Other proteins in same PDB: d5e32a1, d5e32a2
   automated match to d4kdmb_
   complexed with nag; mutant

Details for d5e32b_

PDB Entry: 5e32, 2.7 Å

PDB Description: crystal structure of h5 hemagglutinin mutant (n224k, q226l, n158d and l133a deletion) from the influenza virus a/chicken/vietnam/ncvd- 093/2008 (h5n1)

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d5e32b_:

Sequence; same for both SEQRES and ATOM records:

>d5e32b_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgitnkinsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlye
kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreeisg

Timeline for d5e32b_:

• d5e32b_ first appeared in SCOPe 2.05
  
• d5e32b_ appears in SCOPe 2.07
  
• d5e32b_ appears in the current release, SCOPe 2.08