SCOPe 2.06: Domain d5e2yb1: 5e2y B:2-175

Lineage for d5e2yb1 (5e2y B:2-175)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (12 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)

8. Domain d5e2yb1: 5e2y B:2-175 [279711]
   Other proteins in same PDB: d5e2ya1, d5e2ya2, d5e2yb2, d5e2yc1, d5e2yc2, d5e2yd2, d5e2ye1, d5e2ye2, d5e2yf2
   automated match to d4kdmb_
   complexed with fuc, ful, nag; mutant

Details for d5e2yb1

PDB Entry: 5e2y, 2.6 Å

PDB Description: crystal structure of h5 hemagglutinin q226l mutant from the influenza virus a/duck/egypt/10185ss/2010 (h5n1)

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d5e2yb1:

Sequence; same for both SEQRES and ATOM records:

>d5e2yb1 h.3.1.1 (B:2-175) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
lfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmnt
qfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydk
vrlqlrdnakelgngcfefyhrcdnecmesvrngtydypqyseearlkreeisg

Timeline for d5e2yb1:

• d5e2yb1 first appeared in SCOPe 2.05, called d5e2yb_
  
• d5e2yb1 appears in SCOPe 2.07
  
• d5e2yb1 appears in the current release, SCOPe 2.08