Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.19: Aquaporin-like [81339] (1 superfamily) core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices |
Superfamily f.19.1: Aquaporin-like [81338] (2 families) |
Family f.19.1.0: automated matches [191436] (1 protein) not a true family |
Protein automated matches [190629] (7 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225512] (5 PDB entries) |
Domain d5c5xf_: 5c5x F: [279684] automated match to d3d9sa_ complexed with ps6; mutant |
PDB Entry: 5c5x (more details), 2.6 Å
SCOPe Domain Sequences for d5c5xf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c5xf_ f.19.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kkevcsvaflkavfaeflatlifvffglgsalkwpsalptilqialafglaigtlaqalg pvsgghinpaitlallvgnqisllraffyvaaqlvgaiagagilygvaplnargnlavna lnnnttqgqamvveliltfqlalcifastdsrrtepvgspalsiglsvtlghlvgiyftg csmnparsfgpavvmnrfspahwvfwvgpivgavlaailyfyllfpnslslservaiikg tyep
Timeline for d5c5xf_: