Lineage for d5c5xf_ (5c5x F:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1956981Fold f.19: Aquaporin-like [81339] (1 superfamily)
    core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices
  4. 1956982Superfamily f.19.1: Aquaporin-like [81338] (2 families) (S)
  5. 1957032Family f.19.1.0: automated matches [191436] (1 protein)
    not a true family
  6. 1957033Protein automated matches [190629] (7 species)
    not a true protein
  7. 1957043Species Human (Homo sapiens) [TaxId:9606] [225512] (5 PDB entries)
  8. 1957058Domain d5c5xf_: 5c5x F: [279684]
    automated match to d3d9sa_
    complexed with ps6; mutant

Details for d5c5xf_

PDB Entry: 5c5x (more details), 2.6 Å

PDB Description: crystal structure of the s156e mutant of human aquaporin 5
PDB Compounds: (F:) Aquaporin-5

SCOPe Domain Sequences for d5c5xf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c5xf_ f.19.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkevcsvaflkavfaeflatlifvffglgsalkwpsalptilqialafglaigtlaqalg
pvsgghinpaitlallvgnqisllraffyvaaqlvgaiagagilygvaplnargnlavna
lnnnttqgqamvveliltfqlalcifastdsrrtepvgspalsiglsvtlghlvgiyftg
csmnparsfgpavvmnrfspahwvfwvgpivgavlaailyfyllfpnslslservaiikg
tyep

SCOPe Domain Coordinates for d5c5xf_:

Click to download the PDB-style file with coordinates for d5c5xf_.
(The format of our PDB-style files is described here.)

Timeline for d5c5xf_: