Lineage for d1kopb_ (1kop B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) 
Family b.74.1.1: Carbonic anhydrase [51070] (1 protein) Protein Carbonic anhydrase [51071] (8 species) 
Species Neisseria gonorrhoeae [51079] (2 PDB entries) 
Domain d1kopb_: 1kop B: [27967]
Details for d1kopb_
PDB Entry: 1kop (more details), 1.9 Å
PDB Description: neisseria gonorrhoeae carbonic anhydrase
SCOP Domain Sequences for d1kopb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kopb_ b.74.1.1 (B:) Carbonic anhydrase {Neisseria gonorrhoeae}
hthwgytghdspeswgnlseefrlcstgknqspvnitetvsgklpaikvnykpsmvdven
nghtiqvnypeggntltvngrtytlkqfhfhvpsenqikgrtfpmeahfvhldenkqplv
lavlyeagktngrlssiwnvmpmtagkvklnqpfdastllpkrlkyyrfagslttppcte
gvswlvlktydhidqaqaekftravgsennrpvqplnarvvie
SCOP Domain Coordinates for d1kopb_:
Click to download the PDB-style file with coordinates for d1kopb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kopb_:
- d1kopb_ appears in SCOP 1.57
- d1kopb_ appears in the current release, SCOPe 2.08
View in 3D
