Lineage for d4z3la_ (4z3l A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1926121Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1926373Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1926374Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)
  6. 1926384Protein Major tree pollen allergen [55963] (4 species)
  7. 1926395Species White birch (Betula verrucosa), Bet v 1 [TaxId:3505] [55964] (22 PDB entries)
  8. 1926416Domain d4z3la_: 4z3l A: [279665]
    automated match to d4a87a_
    complexed with so4; mutant

Details for d4z3la_

PDB Entry: 4z3l (more details), 2.5 Å

PDB Description: crystal structure of birch pollen allergen bet v 1 mutant g26l, d69i, p90l, k97i
PDB Compounds: (A:) major pollen allergen bet v 1-a

SCOPe Domain Sequences for d4z3la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z3la_ d.129.3.1 (A:) Major tree pollen allergen {White birch (Betula verrucosa), Bet v 1 [TaxId: 3505]}
gvfnyetettsvipaarlfkafildldnlfpkvapqaissveniegnggpgtikkisfpe
gfpfkyvkirvdevdhtnfkynysvieggligdtleiisneikivatpdggsilkisnky
htkgdhevkaeqvkaskemgetllravesyllahsdayn

SCOPe Domain Coordinates for d4z3la_:

Click to download the PDB-style file with coordinates for d4z3la_.
(The format of our PDB-style files is described here.)

Timeline for d4z3la_: