Lineage for d1kopa_ (1kop A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2077896Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2077897Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2077898Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 2077899Protein Carbonic anhydrase [51071] (10 species)
  7. 2078748Species Neisseria gonorrhoeae [TaxId:485] [51079] (2 PDB entries)
  8. 2078749Domain d1kopa_: 1kop A: [27966]
    complexed with azi, bme, so4, zn

Details for d1kopa_

PDB Entry: 1kop (more details), 1.9 Å

PDB Description: neisseria gonorrhoeae carbonic anhydrase
PDB Compounds: (A:) carbonic anhydrase

SCOPe Domain Sequences for d1kopa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kopa_ b.74.1.1 (A:) Carbonic anhydrase {Neisseria gonorrhoeae [TaxId: 485]}
hthwgytghdspeswgnlseefrlcstgknqspvnitetvsgklpaikvnykpsmvdven
nghtiqvnypeggntltvngrtytlkqfhfhvpsenqikgrtfpmeahfvhldenkqplv
lavlyeagktngrlssiwnvmpmtagkvklnqpfdastllpkrlkyyrfagslttppcte
gvswlvlktydhidqaqaekftravgsennrpvqplnarvvie

SCOPe Domain Coordinates for d1kopa_:

Click to download the PDB-style file with coordinates for d1kopa_.
(The format of our PDB-style files is described here.)

Timeline for d1kopa_: