SCOPe 2.08: Domain d4yo8b1: 4yo8 B:3-231

Lineage for d4yo8b1 (4yo8 B:3-231)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (46 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85963] [189517] (16 PDB entries)

8. Domain d4yo8b1: 4yo8 B:3-231 [279656]
   Other proteins in same PDB: d4yo8a2, d4yo8b2
   automated match to d3nm6b_
   complexed with 4ez, zn

Details for d4yo8b1

PDB Entry: 4yo8, 2.1 Å

PDB Description: crystal structure of helicobacter pylori 5'-methylthioadenosine/s- adenosyl homocysteine nucleosidase (mtan) complexed with (((4-amino- 5h-pyrrolo[3,2-d]pyrimidin-7-yl)methyl)(hexyl)amino)methanol

PDB Compounds: (B:) Aminodeoxyfutalosine nucleosidase

SCOPe Domain Sequences for d4yo8b1:

Sequence; same for both SEQRES and ATOM records:

>d4yo8b1 c.56.2.0 (B:3-231) automated matches {Helicobacter pylori [TaxId: 85963]}
qkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhstltt
tsmilafgvqkvlfsgvagslvkdlkindllvatqlvqhdvdlsafdhplgfipesaifi
etsgslnalakkianeqhialkegviasgdqfvhskerkeflvsefkasavemegasvaf
vcqkfgvpccvlrsisdnadekagmsfdefleksahtsakflksmvdel

Timeline for d4yo8b1:

• d4yo8b1 first appeared in SCOPe 2.05, called d4yo8b_
  
• d4yo8b1 appears in SCOPe 2.07