SCOPe 2.05: Domain d3x1jc_: 3x1j C:

Lineage for d3x1jc_ (3x1j C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)

6. Protein automated matches [190964] (4 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:350703] [279626] (4 PDB entries)

8. Domain d3x1jc_: 3x1j C: [279648]
   automated match to d1gn8a_
   complexed with aco, dms, gol, peg, po4

Details for d3x1jc_

PDB Entry: 3x1j, 2.33 Å

PDB Description: crystal structure of phosphopantetheine adenylyltransferase (ppat/coad) with accoa from pseudomonas aeruginosa

PDB Compounds: (C:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d3x1jc_:

Sequence; same for both SEQRES and ATOM records:

>d3x1jc_ c.26.1.3 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 350703]}
mnrvlypgtfdpitkghgdlierasrlfdhviiavaaspkknplfsleqrvalaqevtkh
lpnvevvgfstllahfvkeqkanvflrglravsdfeyefqlanmnrqlapdvesmfltps
ekysfisstlvreiaalggdiskfvhpavadalaerfk

Timeline for d3x1jc_:

• d3x1jc_ is new in SCOPe 2.05-stable
  
• d3x1jc_ appears in SCOPe 2.06
  
• d3x1jc_ appears in the current release, SCOPe 2.08