Lineage for d1koqa_ (1koq A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1136597Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 1136598Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 1136599Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
  6. 1136600Protein Carbonic anhydrase [51071] (10 species)
  7. 1137093Species Neisseria gonorrhoeae [TaxId:485] [51079] (2 PDB entries)
  8. 1137096Domain d1koqa_: 1koq A: [27964]
    complexed with zn

Details for d1koqa_

PDB Entry: 1koq (more details), 1.9 Å

PDB Description: neisseria gonorrhoeae carbonic anhydrase
PDB Compounds: (A:) carbonic anhydrase

SCOPe Domain Sequences for d1koqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1koqa_ b.74.1.1 (A:) Carbonic anhydrase {Neisseria gonorrhoeae [TaxId: 485]}
thwgytghdspeswgnlseefrlcstgknqspvnitetvsgklpaikvnykpsmvdvenn
ghtiqvnypeggntltvngrtytlkqfhfhvpsenqikgrtfpmeahfvhldenkqplvl
avlyeagktngrlssiwnvmpmtagkvklnqpfdastllpkrlkyyrfagslttppcteg
vswlvlktydhidqaqaekftravgsennrpvqplnarvvie

SCOPe Domain Coordinates for d1koqa_:

Click to download the PDB-style file with coordinates for d1koqa_.
(The format of our PDB-style files is described here.)

Timeline for d1koqa_: