Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
Protein Clp protease, ClpP subunit [52098] (11 species) |
Species Staphylococcus aureus [TaxId:273036] [388880] (3 PDB entries) |
Domain d5dl1f_: 5dl1 F: [279593] automated match to d3qwdc_ complexed with 5c2 |
PDB Entry: 5dl1 (more details), 3 Å
SCOPe Domain Sequences for d5dl1f_:
Sequence, based on SEQRES records: (download)
>d5dl1f_ c.14.1.1 (F:) Clp protease, ClpP subunit {Staphylococcus aureus [TaxId: 273036]} liptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiyl yinspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmi hqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeake yglidevmvpe
>d5dl1f_ c.14.1.1 (F:) Clp protease, ClpP subunit {Staphylococcus aureus [TaxId: 273036]} liptvietteraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyin spggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqp lggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeygl idevmvpe
Timeline for d5dl1f_: