Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.0: automated matches [227160] (1 protein) not a true family |
Protein automated matches [226867] (22 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [232247] (22 PDB entries) |
Domain d5d7ca_: 5d7c A: [279584] automated match to d3u2ka_ protein/DNA complex; complexed with 57w, mg, mpd |
PDB Entry: 5d7c (more details), 1.55 Å
SCOPe Domain Sequences for d5d7ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d7ca_ d.122.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} agqiqvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdn wikvtdngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvp qfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderd eenvredsyhye
Timeline for d5d7ca_: