Lineage for d5cvda_ (5cvd A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864482Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1864483Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1865473Family c.66.1.42: AD-003 protein-like [117685] (3 proteins)
    Pfam PF05891; DUF858
  6. 1865480Protein automated matches [190630] (1 species)
    not a true protein
  7. 1865481Species Human (Homo sapiens) [TaxId:9606] [187677] (2 PDB entries)
  8. 1865482Domain d5cvda_: 5cvd A: [279574]
    automated match to d2ex4b_
    complexed with sah

Details for d5cvda_

PDB Entry: 5cvd (more details), 1.3 Å

PDB Description: crystal structure of human nrmt1 in complex with alpha-n-dimethylated human cenp-a peptide
PDB Compounds: (A:) N-terminal Xaa-Pro-Lys N-methyltransferase 1

SCOPe Domain Sequences for d5cvda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cvda_ c.66.1.42 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glvprgshmtseviedekqfyskaktywkqipptvdgmlggyghissidinssrkflqrf
lregpnktgtscaldcgagigritkrlllplfrevdmvditedflvqaktylgeegkrvr
nyfccglqdftpepdsydviwiqwvighltdqhlaeflrrckgslrpngiivikdnmaqe
gvilddvdssvcrdldvvrriicsaglsllaeerqenlpdeiyhvysfalr

SCOPe Domain Coordinates for d5cvda_:

Click to download the PDB-style file with coordinates for d5cvda_.
(The format of our PDB-style files is described here.)

Timeline for d5cvda_: