![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 protein domains) |
![]() | Protein automated matches [190144] (11 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (156 PDB entries) |
![]() | Domain d5cgfu_: 5cgf U: [279571] Other proteins in same PDB: d5cgfa_, d5cgfe_, d5cgff_, d5cgfi_, d5cgfj_, d5cgfk_, d5cgfl_, d5cgfn_, d5cgfo_, d5cgfs_, d5cgft_, d5cgfw_, d5cgfx_, d5cgfy_, d5cgfz_ automated match to d1rypa_ complexed with cl, mg; mutant |
PDB Entry: 5cgf (more details), 2.8 Å
SCOPe Domain Sequences for d5cgfu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cgfu_ d.153.1.4 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae q
Timeline for d5cgfu_: