Lineage for d1zncb_ (1znc B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1328735Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 1328736Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 1328737Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 1328738Protein Carbonic anhydrase [51071] (10 species)
  7. 1329241Species Human (Homo sapiens), isozyme IV [TaxId:9606] [51076] (4 PDB entries)
  8. 1329251Domain d1zncb_: 1znc B: [27956]
    complexed with so4, zn

Details for d1zncb_

PDB Entry: 1znc (more details), 2.8 Å

PDB Description: human carbonic anhydrase iv
PDB Compounds: (B:) carbonic anhydrase IV

SCOPe Domain Sequences for d1zncb_:

Sequence, based on SEQRES records: (download)

>d1zncb_ b.74.1.1 (B:) Carbonic anhydrase {Human (Homo sapiens), isozyme IV [TaxId: 9606]}
wcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkkqtwt
vqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfamemhiv
hekekgtsrnvkeaqdpedeiavlaflveagtqvnegfqplvealsnipkpemsttmaes
slldllpkeeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyydkeq
tvsmkdnvrplqqlgqrtviks

Sequence, based on observed residues (ATOM records): (download)

>d1zncb_ b.74.1.1 (B:) Carbonic anhydrase {Human (Homo sapiens), isozyme IV [TaxId: 9606]}
wcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkkqtwt
vqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfamemhiv
heedeiavlaflveagtqvnegfqplvealsnipkpemsttmaesslldllpkeeklrhy
frylgslttptcdekvvwtvfrepiqlhreqilafsqklyydkeqtvsmkdnvrplqqlg
qrtviks

SCOPe Domain Coordinates for d1zncb_:

Click to download the PDB-style file with coordinates for d1zncb_.
(The format of our PDB-style files is described here.)

Timeline for d1zncb_: