Lineage for d5cgfi_ (5cgf I:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2549037Protein Proteasome alpha subunit (non-catalytic) [56255] (9 species)
    contains an extension to the common fold at the N-terminus
  7. 2549053Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (198 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2550192Domain d5cgfi_: 5cgf I: [279557]
    Other proteins in same PDB: d5cgfb_, d5cgfc_, d5cgfd_, d5cgfg_, d5cgfh_, d5cgfm_, d5cgfp_, d5cgfq_, d5cgfr_, d5cgfu_, d5cgfv_
    automated match to d4eu2j_
    complexed with cl, mg; mutant

Details for d5cgfi_

PDB Entry: 5cgf (more details), 2.8 Å

PDB Description: yeast 20s proteasome beta5-g48c mutant
PDB Compounds: (I:) Proteasome subunit beta type-3

SCOPe Domain Sequences for d5cgfi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cgfi_ d.153.1.4 (I:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
gwgavvyiikkdevvkrylkmrqd

SCOPe Domain Coordinates for d5cgfi_:

Click to download the PDB-style file with coordinates for d5cgfi_.
(The format of our PDB-style files is described here.)

Timeline for d5cgfi_: