Lineage for d5cgfm_ (5cgf M:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2552691Protein automated matches [190144] (11 species)
    not a true protein
  7. 2552960Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (160 PDB entries)
  8. 2553906Domain d5cgfm_: 5cgf M: [279552]
    Other proteins in same PDB: d5cgfa_, d5cgfe_, d5cgff_, d5cgfi_, d5cgfj_, d5cgfk_, d5cgfl_, d5cgfn_, d5cgfo_, d5cgfs_, d5cgft_, d5cgfw_, d5cgfx_, d5cgfy_, d5cgfz_
    automated match to d4j70m_
    complexed with cl, mg; mutant

Details for d5cgfm_

PDB Entry: 5cgf (more details), 2.8 Å

PDB Description: yeast 20s proteasome beta5-g48c mutant
PDB Compounds: (M:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d5cgfm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cgfm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

SCOPe Domain Coordinates for d5cgfm_:

Click to download the PDB-style file with coordinates for d5cgfm_.
(The format of our PDB-style files is described here.)

Timeline for d5cgfm_: