SCOPe 2.08: Domain d5cgfb_: 5cgf B:

Lineage for d5cgfb_ (5cgf B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)

8. Domain d5cgfb_: 5cgf B: [279549]
   Other proteins in same PDB: d5cgfa_, d5cgfc2, d5cgfe_, d5cgff_, d5cgfi_, d5cgfj_, d5cgfk_, d5cgfl_, d5cgfn_, d5cgfo_, d5cgfq2, d5cgfs_, d5cgft_, d5cgfw_, d5cgfx_, d5cgfy_, d5cgfz_
   automated match to d1rypc_
   complexed with cl, mg; mutant

Details for d5cgfb_

PDB Entry: 5cgf, 2.8 Å

PDB Description: yeast 20s proteasome beta5-g48c mutant

PDB Compounds: (B:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d5cgfb_:

Sequence; same for both SEQRES and ATOM records:

>d5cgfb_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

Timeline for d5cgfb_:

• d5cgfb_ first appeared in SCOPe 2.05
  
• d5cgfb_ appears in SCOPe 2.07