SCOPe 2.05: Domain d4wxkb_: 4wxk B:

Lineage for d4wxkb_ (4wxk B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
   automatically mapped to Pfam PF01327

6. Protein automated matches [190200] (8 species)
   not a true protein

7. Species Haemophilus influenzae [TaxId:281310] [279491] (2 PDB entries)

8. Domain d4wxkb_: 4wxk B: [279493]
   automated match to d1bs4a_
   complexed with gol, ni

Details for d4wxkb_

PDB Entry: 4wxk, 2.05 Å

PDB Description: crystal structure of a peptide deformylase from haemophilus influenzae

PDB Compounds: (B:) Peptide deformylase

SCOPe Domain Sequences for d4wxkb_:

Sequence; same for both SEQRES and ATOM records:

>d4wxkb_ d.167.1.1 (B:) automated matches {Haemophilus influenzae [TaxId: 281310]}
alnvliypddhlkvvcepvtevndairkivddmfdtmyqekgiglaapqvdilqriitid
vegdkqnqfvlinpeilasegetgieegclsipgfralvprkekvtvraldrdgkeftld
adgllaiciqheidhlngilfvdylsplkrqrikeklikykkqi

Timeline for d4wxkb_:

• d4wxkb_ is new in SCOPe 2.05-stable
  
• d4wxkb_ appears in SCOPe 2.06
  
• d4wxkb_ appears in the current release, SCOPe 2.08