Lineage for d5ellb2 (5ell B:117-235)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1873962Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 1874638Superfamily c.78.2: Aspartate/glutamate racemase [53681] (2 families) (S)
  5. 1874657Family c.78.2.0: automated matches [227233] (1 protein)
    not a true family
  6. 1874658Protein automated matches [226982] (3 species)
    not a true protein
  7. 1874659Species Escherichia coli [TaxId:562] [279460] (2 PDB entries)
  8. 1874663Domain d5ellb2: 5ell B:117-235 [279462]
    automated match to d3ojca2

Details for d5ellb2

PDB Entry: 5ell (more details), 1.8 Å

PDB Description: crystal structure of l-aspartate/glutamate-specific racemase from escherichia coli
PDB Compounds: (B:) Asp/Glu_racemase family protein

SCOPe Domain Sequences for d5ellb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ellb2 c.78.2.0 (B:117-235) automated matches {Escherichia coli [TaxId: 562]}
mtrvallgtrytmeqdfyrgrlteqfsinclipeaderakinqiifeelclgqfteasra
yyaqviarlaeqgaqgvifgcteigllvpeersvlpvfdtaaihaedavafmlslehhh

SCOPe Domain Coordinates for d5ellb2:

Click to download the PDB-style file with coordinates for d5ellb2.
(The format of our PDB-style files is described here.)

Timeline for d5ellb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ellb1