Lineage for d5eava_ (5eav A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1867290Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1867291Protein automated matches [190151] (98 species)
    not a true protein
  7. 1868004Species Toxoplasma gondii [TaxId:508771] [256372] (4 PDB entries)
  8. 1868007Domain d5eava_: 5eav A: [279458]
    automated match to d4nogb_
    complexed with peg, so4

Details for d5eava_

PDB Entry: 5eav (more details), 1.6 Å

PDB Description: unliganded structure of the ornithine aminotransferase from toxoplasma gondii
PDB Compounds: (A:) Ornithine aminotransferase, mitochondrial, putative

SCOPe Domain Sequences for d5eava_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eava_ c.67.1.0 (A:) automated matches {Toxoplasma gondii [TaxId: 508771]}
rktnieayrdglklkteedffacdrqyvcqnyapvpvviskgkgarvwdingneyydfla
gvsslsqghchprviaalcrqaerltltlrafgndvtgpacrfmaemfgydrvllmntga
eagesalkiarkwayevkeippdsakvilcnnnywgrtitacsssttfdcynnfgpftpg
felidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgylkrahelcrsknvllivd
eiqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmgradvmdvlkpgthgstf
ggnplacavavealtvlkdekladraerlgaqfrdclrrelygkvpwikeirgrgllnav
evdsdaidpndvvmklkengilskptrgrvmrfipplvitdeehrdattriiksflavee
er

SCOPe Domain Coordinates for d5eava_:

Click to download the PDB-style file with coordinates for d5eava_.
(The format of our PDB-style files is described here.)

Timeline for d5eava_: